PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID snap_masked-scaffold02486-abinit-gene-0.18-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Dof
Protein Properties Length: 324aa    MW: 35764.1 Da    PI: 7.6645
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
snap_masked-scaffold02486-abinit-gene-0.18-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.1e-393998261
                                             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                                       +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  snap_masked-scaffold02486-abinit-gene-0.18-mRNA-1 39 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRS 98
                                                       57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-334197IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-284297IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5064397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MQDIHAMGGG RLFGGGDRRV RPNHHHQHNH HHHHTQTQNH QALKCPRCDS LNTKFCYYNN  60
YNLSQPRHFC KSCRRYWTKG GVLRNVPVGG GCRKAKRSKP KPNSSDASTP QPQRREPKSN  120
SHSSSESSSL TATTNTATEA VSAVTGPSLN SAANLLNVQD SKLFVSSSSY EQGLLEQGSD  180
CGIFSEIGSF TSLITAPSNE TLAFGFNTMS DITTTPFRLN HHQSQSQSQS ENQEWQNQQQ  240
QQKGMGLAGD ELKMQEITGG LLDQTVQVDL SSLQNRSSGG GFGSLDWQAT TGDQGLFDLP  300
NTVDQAYWSQ SQWTDQDHPT LYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815GGRLFGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629172e-59KP662917.1 Cajanus cajan Dof25 (Dof25) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883277.11e-118PREDICTED: dof zinc finger protein DOF5.4
TrEMBLW9RP281e-114W9RP28_9R
STRINGVIT_17s0000g04850.t018e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.18e-57OBF binding protein 4